PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009627553.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family S1Fa-like
Protein Properties Length: 87aa    MW: 9609.37 Da    PI: 10.3062
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009627553.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA132.31.2e-412187470
            S1FA  4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                    + ve+kG+nPGlivl vvggl+l fl+gny+ly+yaqk+lPP+kkkPvskkk+kre+lkqGv++PGe
  XP_009627553.1 21 KDVEVKGFNPGLIVLTVVGGLVLAFLIGNYVLYMYAQKTLPPKKKKPVSKKKMKRERLKQGVSAPGE 87
                    679***************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0190132.0E-62287No hitNo description
PfamPF046894.9E-402387IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MDSEADFDPP PSFDNVKNMA KDVEVKGFNP GLIVLTVVGG LVLAFLIGNY VLYMYAQKTL  60
PPKKKKPVSK KKMKRERLKQ GVSAPGE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2329354e-70AC232935.1 Solanum lycopersicum chromosome 9 clone C09HBa0067J16, complete sequence.
GenBankHG9755214e-70HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009627553.19e-57PREDICTED: DNA-binding protein S1FA-like
RefseqXP_009781429.11e-56PREDICTED: DNA-binding protein S1FA-like
RefseqXP_016432997.11e-56PREDICTED: DNA-binding protein S1FA-like
RefseqXP_016471310.19e-57PREDICTED: DNA-binding protein S1FA-like
SwissprotQ423373e-16S1FA2_ARATH; DNA-binding protein S1FA2
TrEMBLB9SGP84e-30B9SGP8_RICCO; DNA-binding protein S1FA, putative
STRINGPGSC0003DMT4000044414e-28(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31742249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37120.11e-06S1FA-like DNA-binding protein